Head-to-Head: Cucumber.js vs Peeky Analysis

@cucumber/cucumber

v10.3.1(about 2 months ago)

This package is actively maintained.Types definitions are bundled with the npm packageNumber of direct dependencies: 41Monthly npm downloads

@cucumber/cucumber is a powerful and widely-used JavaScript testing framework that enables behavior-driven development (BDD) for your applications. It allows you to write executable specifications in a human-readable format called Gherkin, which promotes collaboration between developers, testers, and stakeholders.

Alternatives:
jest-cucumber+
chai+
mocha+
jasmine+
ava+
tape+
qunit+
jest+
cypress-cucumber-preprocessor+
testcafe+

Tags: javascripttestingbehavior-driven-developmentgherkincollaboration

@peeky/test

v0.14.1(over 1 year ago)

This package was last published over a year ago. It may not be actively maintained.Types definitions are bundled with the npm packageNumber of direct dependencies: 4Monthly npm downloads

@peeky/test is a powerful and flexible testing framework for JavaScript and TypeScript projects. It provides a comprehensive set of features for writing and running tests, including support for various testing styles (e.g., BDD, TDD), test runners (e.g., Mocha, Jest), and assertion libraries (e.g., Chai, Expect). With @peeky/test, you can easily write expressive and readable tests using its intuitive API and powerful test runner integration.

Alternatives:
vitest+
jest+
mocha+
ava+
tape+
chai+
jasmine+
qunit+
karma+
cypress+

Tags: javascripttypescripttestingtest-frameworkbddtdd

Fight!

Popularity

Both @cucumber/cucumber and @peeky/test are popular npm packages within their respective domains. @cucumber/cucumber is widely used for behavior-driven development (BDD) and is particularly popular in the testing community. @peeky/test, on the other hand, is a relatively newer package and is gaining popularity as a testing framework for Vue.js applications.

Domain

@cucumber/cucumber is primarily focused on BDD and provides a feature-rich framework for writing and executing tests using the Gherkin syntax. It is commonly used for testing scenarios and acceptance criteria. @peeky/test, on the other hand, is specifically designed for testing Vue.js applications and provides a simple and intuitive API for writing tests in a Vue.js environment.

Integration

@cucumber/cucumber can be integrated with various testing frameworks and tools, such as Mocha, Jest, and Selenium, making it versatile and adaptable to different testing setups. @peeky/test, on the other hand, is tightly integrated with Vue.js and provides seamless testing capabilities specifically tailored for Vue.js components and applications.

Developer Experience

Both packages offer good developer experiences, but they have different approaches. @cucumber/cucumber focuses on providing a natural language syntax for writing tests, making it readable and understandable for non-technical stakeholders. @peeky/test, on the other hand, focuses on simplicity and ease of use within the Vue.js ecosystem, providing a straightforward API for writing tests for Vue.js components.

Community Support

@cucumber/cucumber has a large and active community with extensive documentation, tutorials, and resources available. It is widely adopted and has a mature ecosystem. @peeky/test, being a newer package, has a smaller community but is growing steadily. It has good documentation and support from the Vue.js community.

Scalability

@cucumber/cucumber is well-suited for large-scale projects with complex scenarios and extensive test suites. It provides features like tags, hooks, and data tables that allow for better organization and management of tests. @peeky/test is more focused on unit testing Vue.js components and may be more suitable for smaller to medium-sized projects.